PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 416aa    MW: 44691.9 Da    PI: 9.4726
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14221genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM21.75.6e-071456649
       NAM  6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                hP+d el++ yL + v++ + +  ++++e+d+y + P+dL +
  EMT14221 14 ASHPSDLELISTYLIPWVSTGERPW-KFVHEADVYAATPQDLAR 56
              569*******************999.89**************73 PP

2NAM39.51.7e-12117211688
       NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknra........tksgyWkatgk 88 
                 hP+d+ l++ yL+++v++ ++++ ++ +++d+y++ P  L +      ++ +ek wyfF+    k+a+g+r  r         t sg W +   
  EMT14221 117 ASHPSDQVLIKSYLTPRVASGQHPC-QFTHDADVYTASPAALTRkyspaLASDGEKAWYFFTLLPAKSAHGQRGARPgparrpggTPSGGWTEEEI 211
               569*******************999.89**************84356644445888*****************99964666666666777765433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-81258IPR003441NAC domain
PROSITE profilePS5100520.173112260IPR003441NAC domain
PfamPF023652.0E-7114237IPR003441NAC domain
SuperFamilySSF1019411.23E-20115260IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAPIRRAAQR PDFASHPSDL ELISTYLIPW VSTGERPWKF VHEADVYAAT PQDLARAYAP  60
ATASDGQEEL GSTSRGGGVI GTSPSATPPR VPRSEALRAA QLPRIPTVPV AQRPDFASHP  120
SDQVLIKSYL TPRVASGQHP CQFTHDADVY TASPAALTRK YSPALASDGE KAWYFFTLLP  180
AKSAHGQRGA RPGPARRPGG TPSGGWTEEE IRQFFSFMTK EEGQRVRSIR SGWIMVEIGL  240
DHGKEEGPSD ELVLCKVYRS PRAGPVEPPA AAGRKRKSGD NYSGSAAPVL TLGPAPGARN  300
STAASTSSSG HKKRKTHSRN SGPVLRPARG VLKLTRPVTS GRKKNSSAER RTPCARCGME  360
PALSHRGTPD PADEEEDGSE TDLDEDDPMT GESGAPHCHR AGESSVCGRT FYQFKI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1312316KRKTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566991.11e-82PREDICTED: uncharacterized protein LOC100830721
TrEMBLN1R2V30.0N1R2V3_AEGTA; NAC domain-containing protein 72
STRINGMLOC_74840.11e-144(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.23e-08NAC domain containing protein 47